Il-17 sukeltas 1 lygio įsijungimas oligodendrocitų pirmtakų ląstelėse skatina proliferaciją ir uždegiminių genų ekspresiją | gamtos komunikacijos

Il-17 sukeltas 1 lygio įsijungimas oligodendrocitų pirmtakų ląstelėse skatina proliferaciją ir uždegiminių genų ekspresiją | gamtos komunikacijos

Anonim

Dalykai

  • Lėtinis uždegimas
  • Interleukinai

Anotacija

NOTCH1 signalizacija prisideda prie defektyvaus remielinizacijos, nes sutrinka oligodendrocitų pirmtakų ląstelių (OPC) diferenciacija. Čia mes pranešame, kad IL-17 stimuliacija sukelia NOTCH1 aktyvaciją OPC, prisidedant prie Th17 tarpininkaujamos demielinizuojančios ligos. Mechaniškai IL-17R sąveikauja su NOTCH1 per tarpląstelinį domeną, o tai palengvina NOTHC1 tarpląstelinio domeno (NICD1) skaidymą. IL-17 sukeltas NOTCH1 aktyvavimas lemia IL-17R adapterio Act1 sąveiką su NICD1, o po to Act1 – NICD1 komplekso perkėlimas į branduolį. Act1 – NICD1 yra įdarbinamas pasitelkiant kelių NOTCH1 taikinių genų (įskaitant STEAP4, metalo reduktazę, svarbią uždegimui ir ląstelių proliferacijai), kurias specialiai sukelia nugaros smegenys Th17 ląstelės, promotorius. Masalų peptidas, sutrikdantis IL-17RA – NOTCH1 sąveiką, slopina IL-17 sukeltą NOTCH1 aktyvaciją ir susilpnina Th17 sukeliamą eksperimentinį autoimuninį encefalitą (EAE). Apibendrinant, šie radiniai rodo kritinį IL-17 ir NOTCH1 kelio susikirtimą, reguliuodami Th17 sukeltus uždegiminius ir proliferacinius genus, kad skatintų demielinizuojančią ligą.

Įvadas

Išsėtinė sklerozė (MS) yra uždegiminė demielinizuojanti centrinės nervų sistemos (CNS) liga, turinti histopatologinius uždegimo, demielinizacijos ir neurodegeneracijos požymius 1 . Nors tikslūs MS patogenezės mechanizmai nėra iki galo išaiškinti, dabartiniai modeliai teigia, kad mielinui reaguojančių T pagalbinių ląstelių populiacijos vaidina pagrindinį vaidmenį inicijuojant ir skleidžiant patologinį procesą 2, 3, 4 . Eksperimentinis autoimuninis encefalomielitas (EAE) yra plačiai naudojamas MS gyvūnų modelis, o elegantiški tyrimai, kuriuose naudojamas šis modelis, apibrėžė patogeninių reiškinių, vykstančių skirtingose ​​EAE / MS vystymosi fazėse, seką 5, 6 . Pradiniame EAE etape suaktyvinami antigenus pristatančios ląstelės drenažo limfmazgiuose ir gamina citokinus, kurie reguliuoja efektorinių CD4 T ląstelių diferenciaciją ir proliferaciją, įskaitant T helper 1 (Th1) ir T helper 17 (Th17) ląstelių linijas. . Th1 ląstelės funkciškai apibūdinamos pagal jų pagamintą IFN-γ ir TNF-α, o Th17 ląstelės gamina IL-17, IL-21 ir IL-22 (nuorodos 7, 8). Neseniai buvo pranešta, kad autoreaktyvios Th1 ir Th17 ląstelės sugeba savarankiškai sukelti EAE per tai, kas, atrodo, yra skirtingi efektorių mechanizmai 9, 10 . Th17 ląstelės susidaro kaip atskira linija, kai naivios CD4 + T ląstelės suaktyvinamos esant transformuojančiam augimo faktoriui β (TGF-β) ir IL-6, ir jos įgyja sugebėjimą greitai plėstis esant IL-23 ( nuorodos 11, 12, 13). Nors žinoma, kad Th17 ląstelės gamina daugybę pagrindinių uždegimą slopinančių citokinų, Th17-tarpininkaujamo EAE efektoriaus stadijoje reikia signalizuoti IL-17, nes dėl IL-17 arba IL-17 receptorių genetinės abliacijos pelės tampa atsparios EAE plėtrai. 14, 15 . Tačiau vis dar neaišku, kokia tiksli ląstelių ir molekulinė bazė, kuria IL-17 dalyvauja MS / EAE patogenezėje.

Act1 yra pagrindinė adapterio molekulė IL-17 signalizacijos kelyje ir skleidžia IL-17 signalizacijos įvykius paskui ligando stimuliaciją 16, 17 . Anksčiau pranešėme, kad Act1 išbraukimas iš neuroektoderminės linijų pelėms (neuronai, oligodendrocitai ir astrocitai) lemia sumažėjusį EAE 18 sunkumą. Mes ištyrėme ląstelinį šio stebėjimo pagrindą. EAE ligos eigai įtakos neturėjo Act1 išbraukimas iš neuronų ar subrendusių oligodendrocitų, o Act1 ištrynimas astrocituose tik šiek tiek paveikė ligos eigą. Išbraukus Act1 iš oligodendrocitų pirmtakų ląstelių (OPC), žymiai sumažėjo EAE sunkumas 19 . Nors IL-17 sukėlė būdingą uždegiminio mediatoriaus ekspresiją OPC, IL-17 taip pat turėjo stiprų slopinantį poveikį oligodendrocitų kilmės ląstelių brendimui in vitro 19 . Šie duomenys nurodo OPC kaip pagrindinį C-CNS ląstelių IL-17 taikinį EAE.

NOTCH signalizacijos kelias yra evoliuciškai išsaugotas kelias, kuris reguliuoja vystymosi procesus tiek bestuburiuose, tiek stuburiniuose. Daugelyje tyrimų, rodančių NOTCH kelio dalyvavimą EAE patogenezėje, daugiausia dėmesio skirta NOTCH vaidmeniui reguliuojant T helpero ląstelių brendimą ir efektorinių ląstelių diferenciaciją 22, 23, 24, 25 . Įrodyta, kad NOTCH kelias kontroliuoja OPC diferenciaciją ir platinimą. Konkrečiai buvo įrodyta, kad NOTCH aktyvacija OPC prisideda prie nekokybiško CIR nervo pašalinimo, nes sutrikdo OPC diferenciaciją į subrendusius oligodendrocitus 26 . Įdomu tai, kad ankstesnis mūsų tyrimas parodė, kad selektyvusis Act1 trūkumas OPC (NG2 + / Olig2 + ) suteikia apsaugą nuo EAE, o gydymas IL-17 slopina OPC diferenciaciją ir sumažina OPC išgyvenamumą 19 . Tačiau tikslus molekulinis mechanizmas, sukeliantis šį poveikį, liko neapibrėžtas. Čia mes pranešame, kad OPC gydymas IL-17 kartu su astrocitais lemia NOTCH1 aktyvaciją OPC ir kad ši naujoji signalizacijos kaskada priklauso nuo tarpląstelinių tiek IL-17 receptorių, tiek NOTCH1. Dėl IL-17 sukeltos NOTCH1 aktyvacijos susidarė Act1 – NICD1 kompleksas, Act1 – NICD1 buvo perkeltas į branduolį, o Act1 ir transkripcijos faktorius RBP-J buvo įdarbinti kelių NOTCH taikinių genų, kurie yra svarbūs uždegimui ir ląstelių dauginimasis. Dėl to IL-17 sukeltas NOTCH1 aktyvavimas OPC paskatino uždegiminį atsaką, ląstelių dauginimąsi ir slopino OPC brendimą. Toliau pabrėžiant patogeninę IL-17 sukeltos NOTCH1 aktyvacijos reikšmę, selektyvios arba NOTCH1, arba RBP-J abliacijos OPC pakako, kad smarkiai sušvelnintų Th17, bet ne Th1 tarpininkaujamo EAE vystymąsi ir sunkumą. Be to, intracerebroventrikulinė apgaulingo peptido injekcija, pagrįsta IL-17RA seka, smarkiai slopino IL-17 sukeltą NOTCH1 aktyvaciją ir susilpnino Th17 tarpininkaujantį EAE.

Rezultatai

„Act1“ tiesiogiai bendrauja su NOTCH1 per NICD1

Norėdami nustatyti naujus sąveikaujančius „Act1“ partnerius, imuninės kilmės nusodinome endogeninį „Act1“ Hela ląstelių lizatuose, apdorotuose IL-17, ir atlikome masės spektrometrinę baltymų, kurių imunoprecipipacija buvo nustatyta kartu su Act1, analizę. Aptikta keletas NOTCH šeimos narių baltymų, įskaitant NOTCH1, NOTCH2 ir NOTCH3 (papildomas 1 pav.). Kadangi Act1 stipriausiai sąveikavo su NOTCH1, nusprendėme sutelkti dėmesį į Act1 – NOTCH1 sąveiką. Act1 sąveika su NOTCH1 buvo patvirtinta imunodepresitacija ir atlikta Western blot analizė (1a pav.). Struktūros ir funkcijos analizė parodė, kad Act1 sąveikauja su ląstelės viduląsteliniu domenu (NICD1), bet ne su NotCH1 tarpląsteliniu domenu (NECD1) (1b pav.). Mes taip pat išnagrinėjo Act1-NICD1 sąveiką vaizdų analizės po transfekcijos su GFP arba RFP pažymėtų baltymų (1 pav. C). Kartu ekspresuojantis su NECD1 (GFP), Act1 (RFP) pirmiausia buvo citoplazmoje ir nebuvo lokalizuotas kartu su NECD1. Dramatiškai kontrastuojant, Act1 buvo lokalizuotas branduolyje su NICD1 (1c pav.). Norėdami vizualizuoti „Act1“ ir NOTCH1 / NICD1 sąveiką, mes atlikome in situ artumo ligavimo bandymą (PLA), naudodami IL-17RA kaip teigiamą kontrolę. Mes nustatėme stiprų signalą apie Act1 – NOTCH1 kompleksą citoplazmoje ir Act1 – NICD1 sąveiką branduolyje (1d pav.).

Image

( a ) HEK293 ląstelės buvo transfekuotos tik HA-Act1 arba kartu su FLAG-NOTCH1. Ląstelių lizatai buvo imunoprecipipuoti anti-FLAG antikūnais, po to atlikta nurodytų baltymų imunobloto analizė. ( b ) HEK293 ląstelės buvo transfekuotos atskirai GFP – NICD1, GFP – NECD1 ir HA – Act1 arba kartu, kaip nurodyta. Ląstelių lizatai buvo imunoprecipipuoti anti-HA antikūnais, po to atlikta nurodytų baltymų imunobloto analizė. Žvaigždutė nurodo nespecifinę juostą. ( c ) HeLa ląstelės buvo transfekuotos GFP – NOTCH1, GFP – NICD1, GFP – NECD1 ir RFP – Act1, kaip nurodyta. Vaizdai buvo gauti naudojant konfokalinę mikroskopiją, naudojant objektyvą × 60; mastelio juosta, 20 μm. Ląstelių, parodančių Act1 – NICD bendrą lokalizaciją branduoliuose, dažnis visuose RFP teigiamose ląstelėse yra parodytas brūkšninėmis schemomis. ( d ) HeLa ląstelės buvo transfekuotos tik HA-Act1 arba kartu su nurodytomis plazmidėmis. In situ PLA buvo atliktas naudojant triušio anti-FLAG ir pelių anti-HA antikūnus, po to ligavimą artumo dėka (žr. Skyrių „Metodai“) ir dažymą DAPI. Raudona: PLA signalas, rodantis baltymų ir baltymų sąveiką; mėlyna: branduoliai. Vaizdai buvo gauti naudojant konfokalinę mikroskopiją, naudojant objektyvą × 60; mastelio juosta, 20 μm. PLA teigiamų ląstelių dažnis parodytas juostų grafikuose. ( e ) HeLa ląstelės buvo transfekuotos tik Hes1-luciferazės reporteriu (100 ng) arba nurodytais žmogaus NICD cDNR (200 ng) deriniais ir didėjančiais žmogaus Act1 cDNR kiekiais (0, 100, 200 ir 500 ng). Duomenys pavaizduoti diagramoje kaip kartotinis luciferazės aktyvumo indukcija iš ląstelių su nurodytu transfekcija, palyginti su vien tik Hes1-luciferazės transfekcija. f ) HEK293 ląstelės buvo transfekuotos FLAG – NICD1 (3 μg), didinant HA-Act1 kiekį (3 ir 6 μg). Ląstelių lizatai buvo imuniniu būdu nusodinti anti-FLAG (viršutinė panelė) arba anti-RBP-J antikūnais (apatinė panelė), po to atlikus nurodytų antikūnų imunobloto analizę. IgG, imunoglobulinas G; IB, imunoblotai; IP, imuninis nusėdimas; WCL, ląstelių lizatai. Rodyklė nurodo FLAG – NICD1 juostą. * P <0, 05, remiantis Manno – Whitney U- testu. Visos klaidų juostos parodo techninių pakartojimų skaičių. Duomenys atspindi tris nepriklausomus eksperimentus.

Visas dydis

Pririšant ligandą, NOTCH1 receptorius suskaidomas ADAM šeimos metaloproteazėmis, po kurių vyksta vidinis membranos γ-sekretazės kompleksas, kad būtų sukurtas NICD1, kuris persikelia į branduolį, kad DNR jungiantis baltymas RBP-J iš transkripcijos represoriaus virstų aktyvatoriu. Šis procesas apima stabiliojo komplekso, susidedančio iš NICD1, RBP-J ir į „Mastermind“ panašių koaktyvatorių (MAML) šeimos, susidarymą, ir jis naudojamas kaip platforma tolesniems kitų koaktyvatorių įdarbinimui, kad suaktyvintų NOTCH1 taikinius ., 21 . Atsižvelgdami į mūsų išvadą, kad „Act1“ galėjo tiesiogiai prisijungti prie NICD1, mes toliau išbandėme, ar „Act1“ turėjo kokį nors poveikį NOTCH1 keliui. Mes nustatėme, kad Act1 galėjo padidinti NOTCH1 tikslinio geno Hes1 varomo reporterio aktyvumą priklausomai nuo dozės, kai jis buvo išreikštas kartu su NICD1 (1e pav.). Tai rodo, kad Act1 gali atlikti teigiamą vaidmenį NOTCH1 kelyje per jo sąveiką su NICD1. Kadangi Act1 yra U-dėžutės turintis E3 27 ligazė, o NICD1, kaip žinoma, reguliuoja 28, 29 ubikvitinacija, tada mes ištyrėme, ar reikalingas Act1 E3 ligazės aktyvumas, norint paveikti NICD1 aktyvumą. Mes nustatėme, kad Act1 E3 mutantas (ΔU-dėžutė) prarado gebėjimą persikelti į branduolį (papildomas 2a pav.) Dėl netinkamo prisijungimo prie NICD1 (papildomas 2b pav.). Dėl to Act1 E3 mutantas negalėjo skatinti NICD1 aktyvumo, palyginti su laukinio tipo Act1 (papildomas 2c pav.). Įdomu tai, kad „Act1“ sukėlė su K63 susietą NICD1 polubikvinitinaciją (papildomas 2d pav.). Visi šie rezultatai leidžia manyti, kad E3 ligazės aktyvumas reikalingas jo gebėjimui skatinti NICD1 aktyvumą, tikriausiai ubiquitinating NICD1. Kadangi Act1 E3 mutantas (ΔU-box) nesugebėjo sąveikauti su NICD1, Act1 tarpininkaujamas NICD1 visureigis gali būti labai svarbus norint užtikrinti Act1 – NICD1 komplekso stabilumą. Norėdami dar geriau suprasti mechanizmą, kuriuo „Act1“ sukuria NICD1 aktyvumą, ištyrėme galimą „Act1“ poveikį NICD1 – RBP-J komplekso formavimui ir koaktyvatorių, tokių kaip MAML1, P300 ir PCAF, įdarbinimui. Įdomu tai, kad „Act1“ buvo aptiktas RBP-J – NICD1 komplekse, o per didelis „Act1“ išraiška padidino MAML1, P300 ir PCAF įdarbinimą į „Act1 – NICD1 – RBP-J“ kompleksą (1 pav. 1f). Visi šie duomenys rodo, kad Act1 tiesiogiai jungiasi prie NOTCH1 per NICD1 ir ubiquitinates NICD1, kad branduolyje sudarytų stabilų kompleksą su NICD1 – RBP-J, palengvinant koaktyvatorių įdarbinimą genų transkripcijai.

IL-17 suaktyvina NOTCH kelią OPC-astrocitų bendrose kultūrose

Ankstesnis mūsų tyrimas atskleidė, kad patogeninis IL-17 signalizacijos poveikis neuroinfekcijos metu yra pats svarbiausias NG2 + OPC, nes selektyvus genetinis Act1 abliacija OPC, bet ne kitose neurologinėse populiacijose palengvino Th17 tarpininkaujantį EAE fenotipą 19 . Tame tyrime nustatyta, kad IL-17 taip pat slopina OPC diferenciaciją, tuo pačiu skatindamas OPC proliferaciją per neaiškų mechanizmą 19 . Gerai žinoma, kad NOTCH1 kelias kontroliuoja OPC diferenciaciją ir proliferaciją, taip pat įrodyta, kad NOTCH1 signalizacija taip pat moduliuoja demielinizaciją / remielinizaciją pelių uždegiminės demielinizuojančios ligos modeliuose 26, 30 . Visi šie duomenys paskatino mus išnagrinėti galimybę, kad IL-17 gali paveikti NOTCH1 kelią OPC. OPC gydymas IL-17 skirtingais laikotarpiais neturėjo pastebimo poveikio NOTCH1 aktyvacijai, vertinant pagal NOTCH1 skilimo produkto NICD1 susidarymą (2a pav.). Ankstesnis tyrimas pasiūlė, kad TGF-β veikia astrocitus, skatindamas NOTCH1 ligando Jagged1 ekspresiją, tokiu būdu suaktyvindamas NOTCH1 OPC ir slopindamas jų diferenciaciją 26 . Remdamiesi ankstesne ataskaita, mes nustatėme NICD1 skilimo padidėjimą OPC, auginamuose kartu su astrocitais, po stimuliacijos TGF-β. Įdomu tai, kad IL-17 taip pat sukėlė NICD1 skilimą šioje bendro kultūros sistemoje, o gydymas IL-17 + TGF-β padidino NICD1 gamybą, palyginti su gydymu vien IL-17 ar TGF-β (2b pav.). Vienas iš galimų NOTCH1 kelio aktyvavimo paaiškinimų šioje sistemoje buvo tas, kad IL-17 gali iš naujo sureguliuoti Jagged1 raišką astrocituose, taip netiesiogiai suaktyvindamas NOTCH1 netoliese esančiuose OPC. Tačiau atlikus astrocitų monokultūros analizę paaiškėjo, kad stimuliuojant gydymu TGF-β ar IL-6 padidinta Jagged1 ekspresija, Jagged1 ekspresija nepakito reaguojant į gydymą IL-17 (2c pav.). Mes taip pat ištyrėme, ar IL-17 gali sureguliuoti kitus NOTCH kelio ligandus astrocituose ir nustatėme, kad IL-17 neturėjo jokios įtakos kitų NOTCH ligandų ekspresijai (papildomas 3 pav.). Visi šie rezultatai rodo, kad IL-17 stimuliacija gali turėti tiesioginį poveikį NOTCH1 aktyvavimui OPC, auginamiems kartu su astrocitais.

Image

( a ) OPC nurodytą laiką buvo stimuliuojami IL-17 (50 ng ml −1 ), po to atlikta nurodytų baltymų imunobloto analizė. ( b ) OPC ir astrocitų kultūros buvo apdorotos IL-17 (50 ng ml −1 ), TGF-β (10 ng ml −1 ) arba IL-17 + TGF-β 24 valandas, po to atlikta imunobloto analizė nurodyti baltymai. c ) Astrocitai nebuvo gydomi arba buvo gydomi IL-17 (50 ng ml −1 ), IL-22 (10 ng ml −1 ), TGF-β (10 ng ml −1 ), IL-6 (10 ng ml –1 ). −1 ), IL − 1 β (1 ug ml − 1 ) ir GM-CSF (10 ng ml − 1 ) 24 valandas, po to atlikta Jagged1 ir aktino imunoblotų analizė. ( d ) OPC ir astrocitų kultūros buvo iš anksto apdorotos dimetilsulfoksidu (DMSO) arba DAPT (10 μM) 6 valandas. Iš anksto apdorotos ląstelės nurodytą laiką buvo stimuliuotos IL-17 (50 ng ml −1 ), po to atlikta imunobloto analizė (kairysis skydelis). Bendrai auginamos laukinio tipo arba NOTCH1 išmušimo (KO) OPC nurodytą laiką buvo stimuliuojamos naudojant IL-17 (50 ng ml −1 ), o po to atlikta imunobloto analizė (dešinė panelė). ( e ) OPC, auginami kartu su laukinio tipo arba NOTCH1 KO astrocitais, nurodytą laiką buvo stimuliuojami su IL-17 (50 ng ml −1 ), o po to atlikta imunobloto analizė. Dviejų nepriklausomų eksperimentų metodu atliktas Western blot'ų densitometrinis kiekybinis įvertinimas parodytas kaip NICD1 indukcija kartų, neapdorotų ląstelių, IL-17 apdorotose ląstelėse. ( f ) Bendrai auginami laukinio tipo arba IL-17RA KO OPC nurodytą laiką buvo stimuliuojami IL-17 (50 ng ml −1 ), po to atlikta nurodytų baltymų imunobloto analizė. ( g ) OPC, auginami kartu su laukinio tipo arba Jagged1 KO astrocitais, nurodytą laiką buvo stimuliuojami IL-17 (50 ng ml −1 ), po to atlikta imunoblotologinė analizė. Densitometrinis kiekybinis įvertinimas atliekamas taip, kaip aprašyta e . ( h ) Bendrai auginami laukinio tipo arba Act1 KO OPC nurodytą laiką buvo stimuliuojami IL-17 (50 ng ml −1 ), po to atlikta nurodytų baltymų imunobloto analizė. Dviejų nepriklausomų eksperimentų metodu atliktas Western blot'ų densitometrinis kiekybinis įvertinimas parodytas kaip NICD1 indukcija kartų, neapdorotų ląstelių, IL-17 apdorotose ląstelėse. ( i ) OPC, auginti kartu su Act1 KO astrocitais, nurodytą laiką buvo stimuliuojami su IL-17 (50 ng ml −1 ). Ląstelių lizatai imuniniu būdu buvo nusodinami anti-Act1 antikūnais, o po to atlikta imunobloto analizė. Visos klaidų juostos žymi techninių pakartojimų skaičių * P <0, 05, remiantis Manno – Vitnio U- testu. Duomenys atspindi tris nepriklausomus eksperimentus.

Visas dydis

NICD1 šalinimas reaguojant į NOTCH receptorių ligaciją yra nuo γ-sekretazės priklausomas procesas. Išankstinis gydymas DAPT (γ-sekretazės inhibitoriumi) panaikino IL-17 sukeltą NICD1 skilimą visais tirtais laiko momentais. Tai rodo, kad IL-17 sukeltas NOTCH aktyvavimas taip pat priklauso nuo γ-sekretazės (2d pav., Kairysis skydelis). . Visų pirma, kultūroje, kuriame yra NOTCH1 KO OPC, buvo panaikintas IL-17 sukeltas NICD1 skilimas, kas rodo, kad IL-17 sukeltas NOTCH1 aktyvavimas yra būdingas OPC (2d pav., Dešinė skiltis). Palaikydami šį atradimą, laukinio tipo OPC kartu su NOTCH1 KO astrocitais nepadarė reikšmingos įtakos IL-17 sukeltam NICD skilimui (2e pav.). Taip pat NOTCH1 aktyvacija buvo visiškai panaikinta kultūroje, kurioje yra IL-17RA KO OPC (2f pav.). Tačiau atsižvelgiant į pastebėjimą, kad IL-17 sukeltai NOTCH1 aktyvacijai OPC reikia astrocitų bendros kultūros, IL-17 sukeltas NICD skilimas buvo visiškai panaikintas OPC kartu su Jagged1 KO astrocitais kultūroje, nurodant, kad Jagged1 išreiškiantys astrocitai buvo būtini IL-17 sukeltai NOTCH aktyvacijai OPC (2g pav.).

Atsižvelgiant į tai, kad Act1 tiesiogiai sąveikauja su ląstelių NOTCH1 intraląsteline sritimi, kitas klausimas buvo, ar Act1 reikalingas IL-17 sukeltam NICD1 skilimui. Keista, kad Act1 trūkumas OPC, auginamuose kartu su astrocitais, lėmė dalinį NICD1 skilimo trūkumą reaguojant į gydymą IL-17, o tai leido manyti, kad IL-17 sukeltas NICD1 skilimas buvo tarpininkaujamas daugiausia receptorių lygmenyje, o Act1 vaidino tik dalinis vaidmuo šiame procese (2h pav.). Įdomu tai, kad nors Act1 buvo įdarbintas į IL-17RA ir NOTCH1 netrukus po IL-17 stimuliacijos (30 min.), NICD1 – Act1 kompleksas buvo aptiktas tik praėjus 8 valandoms po IL-17 stimuliacijos (2i pav.). Nuo y-sekretazės priklausomas procesas tikriausiai lėmė NOTCH1 skilimo uždelsimą po IL-17 sukeltos IL-17R-Act1 sąveikos su NOTCH1. Act1 sąveika su IL-17RA buvo trumpesnė nei sąveika su NOTCH1, tai reiškia, kad Act1 gali likti NOTCH1, kad galų gale sudarytų Act1 – NICD1 kompleksą.

IL-17RA – NOTCH1 sąveika skatina NICD skilimą

Mes nustatėme, kad IL-17 sukeltai NOTCH aktyvacijai reikėjo NOTCH1, IL-17 receptorių ir NOTCH ligando Jagged1 (2d pav., F, g), ir tai rodo, kad šis aktyvavimas gali būti inicijuotas receptoriaus lygmenyje. Toliau mes ištyrėme, ar buvo kokių nors sąveikų tarp IL-17 receptorių ir NOTCH1. Bendras imunoprecipitacija ir in situ PLA atskleidė, kad IL-17RA iš tikrųjų sudarė kompleksą su NOTCH1 (3a, b pav.), Ir šiai sąveikai reikėjo tarpląstelinio NOTCH1 (NECD1) domeno (3c pav.). Taigi, mes hipoteze, kad IL-17R ir NOTCH1 sąveika per tarpląstelinį domeną palengvina NICD1 skaidymą; Tada „Act1 – NICD1“ sudaro kompleksą ir persikelia į branduolį. Pagrįsdamas šią hipotezę, IL-17 stimuliacija iš tikrųjų sukėlė NICD1 ir Act1 branduolio translokaciją OPC-astrocitų kultūroje (laukinio tipo OPC su IL-17RA KO astrocitais), kurią užblokavo N - [(3, 5- Difluorfenil) acetil] -L-alanil-2-fenil] glicino-1, 1-dimetiletilo esteris (DAPT) (γ-sekretazės inhibitorius) (3d pav.). Šis rezultatas leido manyti, kad NICD1 skilimas buvo būtinas atliekant Akto1 – NICD1 branduolio perkėlimą. Nuosekliai, nors Jagged1, kurį ekspresuoja astrocitai, buvo reikalingas IL-17 sukeltam NOTCH1 skilimui kultivavimo sistemoje, NICD1 ir Act1 branduolių translokacija buvo panaikinta OPC, auginamiems kartu su Jagged1 KO astrocitais (papildomas 4 pav.).

Image

a ) HEK293 ląstelės buvo transfekuotos tik V5-IL-17RA arba kartu su HA – NOTCH1. Ląstelių lizatai buvo imunoprecipipuoti anti-HA antikūnais, po to atlikta nurodytų baltymų imunobloto analizė. ( b ) HeLa ląstelės buvo transfekuotos atskirai naudojant FLAG – GFP – NOTCH1 ir V5-IL-17RA arba kartu, kaip nurodyta. In situ PLA buvo atlikti naudojant triušio anti-FLAG ir pelės anti-V5 antikūnus, po to ligavimas in situ artimoje vietoje ir dažymas DAPI. Žalia: GFP (NOTCH1); raudona: PLA signalas; mėlyna: branduoliai. Vaizdai buvo gauti naudojant konfokalinę mikroskopiją, naudojant objektyvą × 60; mastelio juosta, 20 μm. PLA teigiamų ląstelių dažnis GFP teigiamose ląstelėse parodytas brūkšninėje diagramoje. ( c ) HEK293 ląstelės buvo transfekuotos GFP – NICD1 (kairysis skydelis) arba NECD1 (dešinysis skydas) su V5-IL-17RA arba be jo. Ląstelių lizatai buvo imuniniu būdu nusodinti anti-V5 antikūnais, o po to atlikta nurodytų baltymų imunobloto analizė. ( d ) OPC, auginti kartu su IL-17RA KO astrocitais, buvo 6 valandas iš anksto apdoroti DMSO arba DAPT (10 μM). Paskui iš anksto apdorotos ląstelės nurodytą laiką buvo stimuliuojamos IL-17 (50 ng ml −1 ), po to atlikta citoplazmos ir branduolio frakcija. Ląstelių frakcijos buvo tiriamos nurodytais baltymais imunoblotu. Rodyklė nurodo H3 juostas, o žvaigždutė - nespecifinę juostą. ( e ) HEK293 ląstelės buvo transfekuotos GFP – NECD1 kartu su vektoriais arba FLAG pažymėtais IL-17RA delecijos mutantais, kaip nurodyta. Ląstelių lizatai buvo imunoprecipipuoti anti-FLAG antikūnais, po to atlikta nurodytų baltymų imunobloto analizė. IB, imunoblotai; IP, imuninis nusėdimas; WCL, ląstelių lizatai. Klaidų juostos parodo pusę techninių pakartojimų * P <0, 05, remiantis Manno – Whitney U- testu. Duomenys atspindi tris nepriklausomus eksperimentus.

Visas dydis

Išvada, kad IL-17RA tiesiogiai sąveikavo su NOTCH1, paskatino mus atidžiai išanalizuoti baltymų sritis, tarpininkaujančias šiai sąveikai. Mes nustatėme, kad IL-17RA tarpląstelinio domeno (IL-17RA Δ33–320) ištrynimas visiškai panaikino sąveiką tarp IL-17RA ir NECD1, parodydamas, kad IL-17R – NOTCH1 sąveika įvyko per jų tarpląstelinius domenus (3e pav.) . Be to, nuosekli IL-17RA delecijos analizė parodė, kad pašalinus du mažus regionus IL-17RA tarpląsteliniame domene (Δ133–183; Δ283–320), labai sumažėjo IL-17RA – NECD1 sąveika (3e pav.).

NICD1 – Act1 EAE metu persikelia į OPC branduolį

Norėdami išsiaiškinti, ar IL-17 gali sukelti NOTCH1 aktyvaciją ir Act1 – NICD1 branduolio translokaciją in vivo , mes sukūrėme floksuotą HA pažymėtą „Act1“ peleną (į savo lokusą), kuri leido mums sekti endogeninę Act1 ląstelių lokalizaciją in vivo . ląstelių tipui būdingas būdas (4a pav.). Veisdami šią pelių liniją į PDGFRα-CRE (konkrečiai išreikštą OPC) transgeninėmis pelėmis, gavome OPC specifinę HA – Act1 trankomosios pelės liniją (4b pav.), Kuri buvo naudojama stebėti NOTCH1 aktyvaciją ir Act1 ląstelių lokalizaciją. CNS sistemoje Th17 įvaikinančio perdavimo sukelto EAE modelyje (4a pav.). Atlikdami dažymą imunofluorescenciniu būdu, mes pastebėjome, kad Act1 daugiausia buvo ekspresuojamas OPC citoplazmoje (PDGFRα + ląstelės) naivių pelių smegenyse (4b pav.). Įdomu tai, kad praėjus 6 dienoms po Th17 įvaikinimo, Act1 daugiausia buvo lokalizuotas OPC branduoliuose (PDGFRα + ląstelės) (4b pav.). Be to, mes aptikome tvirtą NICD1 dažymą OPC branduoliuose ir tobulą Act1 – NICD1 branduolio lokalizaciją (4c pav.). Šie duomenys pateikė in vivo įrodymų apie IL-17 / Act1 / NOTCH1 ašies funkciją OPC EAE metu.

Image

( a ) LSL – HA – Act1 peiliukų, su kuriais susiduria, dizainas ir generavimas. Norėdami gauti daugiau informacijos, žiūrėkite eksperimentinę procedūrą. ( b, c ) PDGFRα-CRE + LSL – HA – Act1 pelės nebuvo gydomos (naivios) arba buvo perkeltos su MOG reaguojančiomis Th17 ląstelėmis, kad sukeltų EAE. Pelės buvo nužudytos po 6 dienų. Užšaldyti smegenų audinio skyriai iš eksperimentinių pelių buvo dažomi, kad būtų galima parodyti HA-Act1, PDGFRα ( b ) arba NICD ( c ). Vaizdai buvo gauti naudojant konfokalinę mikroskopiją, naudojant objektyvą × 60. Svarstyklės, 10 μm. Ląstelių, kuriose nustatyta Act1 ir NICD bendra lokalizacija Act1 teigiamose ląstelėse, dažnis yra parodytas juostos diagramoje. Klaidų juosta žymi biologinių pakartojimų (pelių) dalį. * P <0, 05, remiantis Manno – Whitney U- testu. Duomenys atspindi tris nepriklausomus eksperimentus.

Visas dydis

IL-17 indukuoja pogrupį nuo NOTCH1 priklausomų genų OPC

IL-17 aktyvina NF-κB ir MAPK kelius, taip sukeldamas uždegiminių genų ekspresiją. Be to, įrodyta, kad IL-17 tarpininkaujantis priešuždegiminis genas yra reikšmingas daugelyje ligų, įskaitant MS / EAE. Atsižvelgiant į stebinančią išvadą, kad IL-17 taip pat gali sukelti NOTCH1 aktyvaciją OPC, mes siekėme išsiaiškinti, ar ši naujoji IL-17 – NOTCH1 ašis vaidina kokį nors vaidmenį EAE patogenezėje. Th1 arba Th17 poliarizuotų mielino oligodendrocitų glikoproteinų (MOG) reaktyvios T ląstelės buvo perkeltos naiviam recipientui. EAE ligos piko metu buvo atlikta genetinių raiškos analizė nugaros viršuje recipientui. Bioinformatikos analizė atskleidė, kad daugybė genų buvo specialiai indukuoti Th17 ląstelių gavėjų nugaros smegenyse (5a pav.). Mes nustatėme, kad IL-17 stimuliacija galėjo sukelti šiuos Th17 specifinius genus laukinio tipo OPC, kultivuojamiems su Act1 KO astrocitais, bet ne Act1 KO OPC kultūrai (5b pav.). Įdomu tai, kad šių Th17 specifinių genų indukcija buvo panaikinta NOTCH1 KO OPC kultūrose, įskaitant uždegiminius genus CXCL1 , STEAP4 , PTX3 , S100A9 , CCL7 ir CP (5c pav.). Visi šie genų produktai, išskyrus STEAP4, anksčiau buvo įtraukti į MS / EAE patogenezę. Svarbu pažymėti, kad, palyginti su astrocitų ir OPC bendra kultūra, vien tik OPC stimuliacija IL-17 sukėlė daug mažesnį aukščiau nurodytų IL-17 sukeltų genų ekspresijos lygį (papildomas 5a pav.). Kaip kontrolę mes parodėme, kad TGF-β nesugebėjo iš naujo sureguliuoti šių IL-17 sukeltų genų astrocitų ir OPC kultūroje. Tačiau kadangi Hes5 ir Hes7 buvo stipriai indukuojami TGF-β, priklausomai nuo NOTCH1, šie abu genai nebuvo indukuoti IL-17 astrocitų ir OPC kultūroje (papildomas 5b, c pav.).

Image

( a ) Laukinio tipo ir Act1 KO pelės nebuvo gydomos arba perkeliamos su Th1 arba Th17 ląstelėmis, kad sukeltų EAE. Ligos piko metu pelės buvo nužudytos, o stuburo smegenys buvo tiriamos mikrotraumu. Genai, kuriuos specialiai sukėlė Th17, palyginti su naivių pelių stuburo virvelėmis, yra parodyti šilumos žemėlapyje (rodyklės rodo NOTCH taikinius, nurodytus literatūroje 41, 42, 43 ). ( b ) Laukinio tipo arba Act1 KO OPC, auginami kartu su Act1 KO astrocitais, nurodytą laiką buvo stimuliuojami IL-17 (50 ng ml −1 ), po to atlikta nurodytų genų RT – PCR analizė. c ) Laukinio tipo arba NOTCH1 KO OPC, auginami kartu su Act1 KO astrocitais, nurodytą laiką buvo stimuliuojami su IL-17 (50 ng ml −1 ), po to atlikta nurodytų genų RT – PCR analizė. * P <0, 05, remiantis Manno – Whitney U- testu. Visos klaidų juostos parodo techninių pakartojimų skaičių. Duomenys atspindi tris nepriklausomus eksperimentus.

Visas dydis

Kadangi IL-17 sukelia Akto1 – NICD1 komplekso branduolinį perkėlimą, mes toliau klausėme, ar Aktas1 – NICD1 galėtų sudaryti kompleksą su RBP-J tų Th17 sukeltų NOTCH taikinių promotoriuose. Bendras imunoprecipitacija parodė, kad IL-17 stimuliacija iš tikrųjų sukėlė Act1 sąveiką su NICD1 ir RBP-J OPC kultūrose (laukinio tipo OPC su Act1 KO astrocitais) (6a pav.). Chromatinu atlikto IL-17 apdorotų OPC kultūrų (laukinio tipo OPC su Astr1 KO astrocitais) imunoprecipitacijos analizė parodė, kad RBP-J buvo įdarbintas STEAP4, PTX3, S100A9 ir CCL7 promotoriaus regione, reaguojant į IL-17 stimuliaciją. Tačiau mes nepastebėjome RBP-J įdarbinimo pas CXCL1 ar CP promotorių. Šie duomenys rodo, kad STEAP4, PTX3, S100A9 ir CCL7 yra tiesioginiai taikiniai IL-17 – NOTCH ašies genai, tuo tarpu CXCL1 ir CP raišką gali reguliuoti netiesioginis mechanizmas (6b pav.). Šios išvados paskatino mus išnagrinėti Act1 įdarbinimą STEAP4, PTX3, S100A9 ir CCL7 promotorių regionuose IL-17 gydomuose OPC kokultūrose (laukinio tipo OPC su Act1 KO astrocitais). Iš tikrųjų, atspindėdamas tai, ką pastebėjome naudodamiesi NOTCH transkripcijos koeficientu RBP-J, Act1 taip pat buvo įdarbintas šių genų promotoriaus regione, reaguojant į gydymą IL-17 (6b pav.). Pažymėtina, kad IL-17 sukeltas Act1 verbavimas šiems promotoriams buvo visiškai užblokuotas γ-sekretazės inhibitoriumi DAPT (6c pav.), Rodantis, kad Act1 prisijungimas prie Th17 sukeltų NOTCH taikinių genų priklausė nuo NOTCH aktyvacijos / skilimo. NICD1 – Act1 sąveika ir branduolių perkėlimas.

Image

a ) Laukinio tipo OPC, auginti kartu su Act1 KO astrocitais, nurodytą laiką buvo stimuliuojami su IL-17 (50 ng ml −1 ). Ląstelių lizatai imuniniu būdu buvo nusodinami anti-Act1 antikūnais, po kurių imamas imunoblotas. ( b ) Laukinio tipo OPC, auginti kartu su Act1 KO astrocitais, nurodytą laiką buvo stimuliuojami su IL-17 (50 ng ml −1 ). Stimuliuojamoms ląstelėms buvo atliktas ChIP tyrimas naudojant anti-RBP-J arba anti-Act1 antikūnus nurodytų promotorių praturtinimui. c ) Laukinio tipo OPC, auginti kartu su Act1 KO astrocitais, buvo 6 valandas iš anksto apdoroti DMSO arba DAPT (10 μM). Iš anksto apdorotos ląstelės nurodytą laiką buvo stimuliuojamos IL-17 (50 ng ml −1 ), po to atliktas ChIP tyrimas, naudojant nurodytų promotorių RBP-J ir Act1 antikūnus. ( d ) NG2 + OPCs ląstelės buvo lentivirusiškai transduotos naudojant kontrolinę shRNR (shControl) arba dvi skirtingas shRNR, nukreiptas į STEAP4. Smūgio efektyvumas buvo nustatytas atliekant imunobloto analizę. Užkrėstos NG2 + OPC ląstelės, kultivuojamos kartu su Act1 KO astrocitais, buvo tiriamos BrdU inkorporacijos tyrimu po gydymo IL-17 (50 ng ml −1 ) 24 valandas. Iš viso iš 10 skirtingų rodinių BrdU teigiamumui buvo išmatuota 1000 NG2 + ląstelių (viršutinė plokštė). NG2 + OPCs ląstelės, transduotos naudojant kontrolinę shRNR arba shRNR, nukreipiančią į STEAP4, buvo kultivuojamos su Act1 KO astrocitais ir 24 valandas buvo apdorotos IL-17 (50 ng ml −1 ). CNP ir MBP raiškos buvo analizuojamos RT – PCR (apatinė panelė). IB, imunoblotai; IP, imuninis nusėdimas; WCL, ląstelių lizatai CNP, 2 ', 3'-ciklinio nukleotido 3'-fosfodiesterazė; MBP, mielino pagrindinis baltymas. * P <0, 05, remiantis Manno – Whitney U- testu. Visos klaidų juostos parodo techninių pakartojimų skaičių. Duomenys atspindi tris nepriklausomus eksperimentus.

Visas dydis

Svarbu pažymėti, kad kai kurie iš Th17 sukeltų NOTCH taikinių genų, tokių kaip STEAP4 ir S100A9 , iš tikrųjų turi dvigubą vaidmenį uždegiminėse ir proliferacinėse reakcijose. 31, 32, 33, 34, 35 . Pranešama, kad STEAP4, metaloreduktazė, turinti NADPH oksidazės (NOX) aktyvumą, ląstelių metabolizme ir ląstelių dauginimosi procese. Iš tiesų nustatyta, kad IL-17 sukeltas STEAP4 ekspresas skatina keratinocitų proliferaciją 31 . Taigi, mes pasidomėjome, ar STEAP4 taip pat gali vaidinti įtaką OPC plitimui ir diferenciacijai. Mes numušėme STEAP4 ekspresiją OPC, naudodami lentivirusinę shRNR, tada ištyrėme ląstelių proliferaciją ir diferenciaciją kultūroje su IL-17RA KO astrocitais. STEAP4 numušimas susilpnino IL-17 sukeltą OPC proliferaciją ir panaikino IL-17 tarpininkaujamą OPC diferenciacijos slopinimą (6d pav.). Šie duomenys rodo, kad IL-17 vaidmuo OPC proliferacijoje ir diferenciacijoje gali būti bent iš dalies priklausomas nuo STEAP4 indukcijos.

NOTCH1 abliacija OPC pagerina Th17 sukeltą EAE

Šiame tyrime nustatyti IL-17 – NOTCH ašies sukelti genai anksčiau buvo įtraukti į MS / EAE 36, 37 patogenezę . Todėl mes iškėlėme hipotezę, kad OPC būdingas NOTCH1 gali kritiškai paveikti Th17 tarpininkaujamą EAE plėtrą. Norėdami patikrinti šią hipotezę, sukūrėme NG2 ER-Cre NOTCH1 f / + ir NG2 ER-Cre NOTCH1 f / f peles, kad būtų galima konkrečiai panaikinti NOTCH1 išraišką NG2 + OPC. Imunofluorescencija patvirtino efektyvų NOTCH1 trynimą nugaros smegenų NG2 + OPC ląstelėse po tamoksifeno indukuoto NOTCH1 išeikvojimo. Įdomu tai, kad visos NG2 + OPC ląstelės išreiškė NOTCH1 remiantis imunofluorescenciniu dažymu (7a pav.). Tada MOG reaguojančios Th17 ląstelės buvo perkeltos į subletaliai apšvitintas NG2 ER-Cre NOTCH1 f / + ir NG2 ER-Cre NOTCH1 f / f pelių gavėjus, kurios parodė, kad Th17 ląstelių sukelto EAE sunkumas labai sumažėjo NG2 ER- „Cre NOTCH1“ f / f pelės, palyginti su kontrolinėmis pelėmis (7b pav.). Smegenis infiltruojančių vieno branduolio ląstelių populiacijų analizė atskleidė, kad NG2 ER-Cre NOTCH1 f / f pelėse buvo mažiau infiltruojančių CD4 + ląstelių, makrofagų, neutrofilų ir B ląstelių, palyginti su kontrolinėmis pelėmis (7c pav.). Histopatologinė analizė atspindėjo šias išvadas, o NG2 ER-Cre NOTCH1 f / f pelių stuburo smegenyse stebėta mažesnė uždegiminė infiltracija ir demielinizacija (8a pav.). Pažymėtina, kad genų, tiesiogiai kontroliuojamų IL-17 – NOTCH1 ašimi (CXCL1, STEAP4 ir PTX3), ekspresija stuburo virkštelėse iš NG2 ER-Cre NOTCH1 f / f gavėjų buvo žymiai sumažinta, palyginti su kontrole (8b pav.). .

Image

( a ) Skersinės juosmens stuburo smegenų dalys iš nurodytų genotipų pelių ( n = 5) buvo dažytos anti-NG2 (raudonais) ir anti-NOTCH1 (žaliaisiais) antikūnais. Tada vaizdai buvo gauti naudojant konfokalinę mikroskopiją, naudojant objektyvą × 60; mastelio juosta, 20 μm. Siekiant įvertinti delecijos efektyvumą, buvo nustatyti NOTCH1 NG2 + ląstelių dažniai. ( b ) Nurodytų genotipų pelės buvo pritaikytos MOG reaguojančioms Th17 ląstelėms ( n = 5), kad sukeltų EAE. Nugaros smegenys buvo renkamos ligos piko metu. Tiriamiesiems pelėms nustatyti klinikiniai EAE simptomų dydžiai nubraižyti per grafiką. ( P <0, 0001, remiantis dvipuse ANOVA). c ) Pelių smegenyse esančios infiltruojančios ląstelės su Th17 sukeltu EAE ( n = 5) buvo išskirtos ligos piko metu, po to atlikta srauto citometrijos analizė. Kiekvienai pelei buvo apskaičiuotas skirtingų infiltruojančių ląstelių skaičius. Visos klaidų juostos žymi biologinių pakartojimų skaičių. * P <0, 05, remiantis Manno – Whitney U- testu. Duomenys atspindi tris nepriklausomus eksperimentus.

OPC susilpnina Th17 sukeltą EAE. "Rel = nofollow> Viso dydžio vaizdas

Image

a ) Pelių juosmens stuburo smegenų skersinių pjūvių hematoksilino ir LFB dažymas Th17 sukeltu EAE. Mastelio juostos, 50 μm (kairiajame skydelyje), 100 μm (dešiniajame skydelyje). b ) Nurodytų genotipų EAE pelių ( n = 5) stuburo smegenų uždegiminių genų ekspresijos RT – PGR analizė. ( c ) skersinės, užšaldytos juosmens stuburo smegenų dalys, aprašytos b punkte, buvo dažytos anti-NG2 (raudonais) ir anti-Ki67 (žaliaisiais) antikūnais. Iš trijų nenuoseklių skyrių iš to paties stuburo smegenų buvo suskaičiuotas bendras NG2 + ląstelių ir Ki67 + NG2 + dvigubai teigiamų ląstelių skaičius. Apskaičiuotas vidutinis Ki67 + NG2 + ląstelių procentas. Nubraižytos kiekvieno genotipo procentinės vertės ( n = 5). Vaizdai buvo gauti naudojant konfokalinę mikroskopiją su × 60 objektyvu; mastelio juosta, 40 μm. ( d ) Stuburo virvutės iš nurodytų pelių buvo surinktos praėjus 14 dienų arba 21 dienai po Th17 sukeltos EAE smailės. Skersinės juosmens stuburo smegenų dalys buvo dažytos anti-GST-π (žalia) ir anti-PDGFRα (raudona) antikūnais. GST-π-teigiamų ir PDGFRα-teigiamų ląstelių dažnis buvo nustatytas rankiniu būdu. Klaidų juostos žymi biologinių pakartojimų skaičių. * P <0, 05, remiantis Manno – Whitney U- testu. Duomenys atspindi du nepriklausomus eksperimentus.

Visas dydis

Ankstesniame tyrime mes pranešėme, kad priėmus į MOG reaguojančias Th17 ląsteles, NG2 + OPC ląstelių populiacija buvo išplėsta laukinio tipo pelių CNS, bet ne NG2 Cre Act1 f / pelėms 19 . Todėl mes spėliojome, kad IL-17 sukeltas NOTCH1 aktyvumas galėjo prisidėti prie šio fenotipo atsiradimo, nes žinoma, kad NOTCH kelias skatina OPC proliferaciją ir trukdo OPC diferenciacijai 26 . Th17 tarpininkaujant EAE, kontrolinių pelių stuburo virkštelėse Ki67 + NG2 + ir PDGFRα + OPC ląstelių procentas buvo žymiai didesnis nei NG2 ER-Cre NOTCH1 f / f pelėse (8c pav., D). Šie rezultatai rodo, kad IL-17 – Act1 – NOTCH1 signalizacija gali skatinti OPC proliferaciją ir taip sušvelninti tinkamą OPC subrendimą, reikalingą remielinizacijos procesui po Th17 sukeltos demielinizacijos. Remiant šią išvadą, subrendusių oligodendrocitų (GST-π + ląstelių) kontrolinėse pelėse buvo labai mažai, palyginti su NG2 ER-Cre NOTCH1 f / f pelėmis (8d pav.). Norėdami patikrinti, ar NOTCH aktyvacija vaidina specifinį vaidmenį Th17 tarpininkaujamame EAE, mes pritaikėme MOG reaguojančias Th1 ląsteles į subletaliai apšvitintas NG2 Cre NOTCH1 f / + ir NG2 ER-Cre NOTCH1 f / f gaunančias peles. NG2 specifinis NOTCH1 išbraukimas nepadarė pastebimo poveikio TH1 sukeltai EAE, įskaitant klinikinę reikšmę, ląstelių infiltraciją ar genų ekspresiją, dar labiau pabrėždamas NOTCH aktyvacijos vaidmenį IL-17 kelyje OPC (papildomas 6 pav.) .

Be NOTCH1, mes taip pat nustatėme, kad Act1 kartu su NOTCH2 ir NOTCH3 buvo imunodepresuotas remiantis MS spektro identifikacija (papildomas 1 pav.). Be to, mikrotraumos analizė atskleidė, kad NOTCH2 taip pat buvo sukeltas pelių, gavusių MOG-reaguojančių Th17 ląstelių, stuburo smegenyse (papildomi duomenys 1). Atsižvelgiant į tai, kad RBP-J yra bendras transkripcijos faktorius visiems NOTCH nariams, mes sukūrėme NG2 ER-Cre RBP-J f / + ir NG2 ER-Cre RBP-J f / f peles. Western blot analizė parodė, kad RBP-J ekspresija buvo visiškai panaikinta NG2 + OPC ląstelėse, gautose iš NG2 Cre RBP-J f / f (papildomas 7a pav.). Po MOG-reaktyvių Th17 ląstelių perkėlimo, EAE fenotipas NG2 ER-Cre RBP-J f / f pelėse, palyginti su kontrolinėmis pelėmis, buvo dramatiškai sumažėjęs (papildomas 7b pav.). NG2 specifinės RBP-J delecijos įtaka Th17 sukeltai EAE buvo reikšmingesnė nei NG2 specifinės NOTCH1 delecijos, sukeliančios galimą NOTCH2 / 3 dalyvavimą šioje IL-17 – NOTCH ašyje Th17 sukelto EAE metu. Tačiau NG2 specifinis RPB-J trynimas neturėjo pastebimo poveikio Th1 sukeltai EAE (papildomas 7c pav.). Kartu šie duomenys parodė, kad kiti NOTCH1 keliai, išskyrus NOTCH1, taip pat gali vaidinti lemiamą vaidmenį Th17, bet ne Th1 tarpininkaujamo, EAE patogenezėje.

Sutrikusi IL-17RA – NOTCH1 sąveika susilpnina EAE

Remdamasis paviršiaus paveiktomis baltymų sekos sritimis, viliojimo peptidas gali turėti galimybę prisijungti prie pradinio baltymo sąveikaujančio partnerio ir užimti jo jungiamąją vietą, nutraukdamas baltymo ir baltymo sąveiką 38 . Mūsų delecijos analizė parodė, kad IL-17RA ir NOTCH1 sąveikavo tarpusavyje per tarpląstelinius domenus, o IL-17RA sąveikai su NOTCH1 reikėjo aminorūgščių liekanų 280–320 IL-17RA (3e pav.). To disrupt the interaction between IL-17RA and NOTCH1, a decoy peptide (with a fluorescein isothiocyanate (FITC) tag at its C terminus) was generated based on the sequence from 280–320 of IL-17RA (RA peptide). As a control, we showed that the RA peptide did not have any impact on IL-17-induced NF-κB and MAPK activation (Fig. 9a), suggesting that this peptide probably does not interrupt IL-17 binding to the receptor. Strikingly, the addition of RA peptide greatly reduced IL-17-induced NOTCH activation (NICD1 cleavage) in OPC co-culture with Act1 KO astrocytes (Fig. 9b). The co-immunoprecipitation experiment showed that this peptide interrupted IL-17RA and NOTCH1 binding (Fig. 9c). Furthermore, the decoy peptide completely abolished IL-17-induced inflammatory gene expression in OPC+astrocyte co-culture (Fig. 9d) and attenuated the IL-17-mediated impact on OPC proliferation and differentiation (Fig. 9e).

Image

( a ) Mouse embryonic fibroblasts were pretreated with control peptide or IL-17RA decoy peptide for 2 h (200 μM). Pretreated cells were stimulated with IL-17 (50 ng ml −1 ) for indicated time, followed by immunoblot analysis. ( b ) OPCs co-cultured with Act1 KO astrocytes were stimulated by IL-17 (50 ng ml −1 ) in the presence of different doses of IL-17RA decoy peptide (50, 100 and 200 μM), followed by immunoblotting analysis. ( c ) HEK293 cells were transfected with indicated constructs. IL-17RA decoy peptide (100 or 200 μM) was added after transfection. Cell lysates were immunoprecipitated with anti-FLAG antibody, followed by immunoblot analysis. ( d ) OPCs co-cultured with IL-17RA KO astrocytes were pretreated with IL-17RA decoy peptide (200 μM) or left untreated followed by IL-17 stimulation (50 ng ml −1 ). Expressions of indicated genes were analysed by RT–PCR. ( e ) OPCs co-cultured with IL-17RA KO astrocytes were pretreated with RA peptide (200 μM) or left untreated followed by IL-17 (50 ng ml −1 ) stimulation. Treated cells were subjected BrdU incorporation assay. A total of 1, 000 NG2 + cells were enumerated from 10 different views for BrdU positivity (left panel). Cells receiving the same treatment were analysed for MBP and CNP expression (right panel). ( f ) Wild-type OPCs and NOTCH1 KO OPCs were incubated for FITC-labelled IL-17RA decoy peptide (200 μM) followed by staining with fluorophore (PE)-labelled anti-NOTCH1 antibody. Cells were analysed by flow cytometry for FITC and PE signal. ( g ) Clinical scores of EAE symptoms of mice receiving indicated treatment ( P <0.001, two-way ANOVA). ( h ) Infiltrating cells from the brain of EAE mice ( n =5) receiving indicated treatment were analysed by flow cytometry. ( i ) RT–PCR analysis of inflammatory gene expression in spinal cords of mice receiving indicated treatment ( n =5). ( j ) H&E and LFB staining of sections of spinal cords from mice receiving indicated treatment. Arrow in the H&E staining indicates infiltrated area, and arrow in the LFB staining indicates demyelination area. Svarstyklės, 100 μm. IB, imunoblotai; IP, immunoprecipitation; WCL, ląstelių lizatai. All error bars represent sem of biological replicates. * P <0.05 based on Mann–Whitney U -test. Duomenys atspindi du nepriklausomus eksperimentus.

Visas dydis

To confirm that the RA peptide could directly bind to NOTCH1, we stained wild-type and NOTCH1 KO OPCs with the decoy RA-peptide-FITC and NOTCH1 antibody. Flow cytometry analysis showed that wild-type OPCs, but not NOTCH1 KO OPCs, co-stained with NOTCH1 and RA-peptide-FITC, implicating that this peptide could bind directly to NOTCH1 (Fig. 7f). The residual NOTCH1-positive signalling in the NOTCH1 KO sample might be due to incomplete depletion of NOTCH1 by adenovirus expressing cre-mediated depletion (Fig. 9f). Notably, most of the OPCs were NOTCH1 positive (Fig. 9f), which is consistent with the literature 26 and the data shown in Fig. 7a. Since this decoy peptide was efficacious for blocking IL-17-induced NOTCH1 activation in co-cultures (without inhibition of TGF-β - induced NOTCH1 activation, Supplementary Fig. 8), we next tested whether it had any therapeutic effect on Th17-induced EAE. To overcome the blood–brain barrier, we used an osmotic pump to continuously deliver RA peptide into the CNS by intracerebroventricular injection. Interestingly, the administration of RA peptide significantly attenuated the Th17-mediated EAE severity (Fig. 9g), reduced the CNS-infiltrated macrophages and neutrophils (Fig. 9h) and decreased Th17-induced expression of NOTCH genes in the spinal cord (Fig. 9i). Histopathological analysis also indicated reduced inflammatory infiltration and demyelination in spinal cords in the peptide-treated group (Fig. 9j). Thus, the RA peptide has a potent therapeutic effect on Th17-mediated EAE, probably by disrupting the IL-17RA–NOTCH axis in OPCs.

Diskusija

In the present study, we report for the first time that IL-17 crosstalks with NOTCH1, a pathway that is known to promote OPC proliferation and suppress OPC differentiation, contributing to demyelinating disease. IL-17R interacts with NOTCH1 via the extracellular domain, which facilitates the cleavage of NICD1, formation of the Act1–NICD1 complex and subsequent translocation into the nucleus. As a result, Act1 and the transcription factor RBP-J are recruited to the promoters of several Th17-induced NOTCH1 target genes, such as STEAP4 , which are critical for inflammation and cell proliferation. Mechanistically, we found Act1 enhanced the interaction of NICD1 with co-activators of the transcription factor RBP-J, thereby promoting expression of the target genes. Selective genetic ablation of either NOTCH1 or RBP-J in OPCs attenuated the development and severity of Th17- but not Th1-mediated EAE. A decoy peptide of IL-17RA 280–320, which was required for NOTCH–IL-17RA interaction, inhibited IL-17-induced NOTCH1 activation, blocked the impact of IL-17 on the OPC inflammatory response, proliferation and maturation, and attenuated Th17-mediated EAE. Taken together, these findings demonstrated that IL-17-induced NICD1–Act1 nuclear translocation promoted inflammatory gene induction in OPCs that enhanced cell proliferation and interfered with OPC maturation, providing a new mechanism for the IL-17 and NOTCH1 pathways in demyelinating disease (Fig. 10).

Image

Left panel: canonical IL-17 signalling. IL-17 signals through a heterodimeric receptor complex composed of IL-17RA and IL-17RC. On IL-17 stimulation, Act1 is recruited to IL-17R and subsequently engages TRAF6 and Hsp90 to activate NF-κB pathway. In addition, IL-17 stimulation also promotes the formation of Act1–IKKi complex, which in turn engages TRAF2 and TRAF5 to activate the mRNA stabilization pathway. Canonical IL-17 signalling results in transcription of pro-inflammatory and neutrophil-mobilizing cytokines and chemokines; Right panel: IL-17–NOTCH pathway. In the OPC-astrocyte co-culture system, IL-17 stimulation induces NOTCH1 activation in the OPCs, resulting in inflammatory gene expression accompanied by enhanced cell proliferation and impaired maturation. IL-17 receptor A (IL-17RA) can directly interact with the NOTCH receptor NOTCH1, leading to the cleavage of the NICD. Furthermore, Act1, the adaptor protein for IL-17 signalling, forms a complex with NICD in response to IL-17 stimulation. The Act1–NICD complex translocates into the nucleus where Act1–NICD and transcription factor RBP-J are recruited to the promoters of NOTCH target genes important for inflammation and cell proliferation.

Visas dydis

Act1 is a key adaptor molecular in IL-17 pathway and plays a very important role in IL-17 signal transduction 17 . Herein, we report for the first time a nucleus function of Act1. On ligand binding, NOTCH1 receptor is cleaved by ADAM family metalloproteases, followed by intramembrane γ-secretase complex, generating NICD that translocates into nucleus to convert the DNA-binding protein RBP-J from a transcriptional repressor into an activator. This process involves the formation of a stable complex which composes of NICD, RBP-J and Mastermind-like family of co-activators (MAML), and the complex serves as a platform to further recruit other co-activators for the activation of NOTCH target genes 20, 21 . We now found that Act1 forms a complex with NICD–RBP-J and increases the recruitment of co-activators MAML1, P300 and PCAF to NICD–RBP-J. It is possible that in response to IL-17 treatment, Act1 might recruit additional co-activators to NICD–RBP-J, directing NICD–RBP-J binding specifically to the Th17-induced NOTCH target genes, including STEAP4, PTX3, S100A9 and CCL7 (Fig. 10).

In the present study, we found that IL-17 could not activate NOTCH1 in OPC single culture conditions, but it could fully activate NOTCH1 in OPCs co-cultured with astrocytes. Jagged1 expressed on astrocytes has been shown to inhibit OPC differentiation and myelination 26, making it a possible candidate in the IL-17-induced NOTCH1 activation process. Indeed, the co-culture of OPCs with Jagged1 KO astrocytes abolished IL-17-induced NOTCH1 activation, indicating that Jagged1 is indispensable for IL-17-induced NOTCH1 activation. One of the key events in NOTCH activation is the release of the NOTCH ectodomain through ligand-induced and ADAM-mediated NOTCH cleavage at cleavage site S2. This cleavage site resides within the negative regulatory region of NOTCH, which functions to prevent NOTCH activation. Since our data showed that IL-17R interacted with the extracellular domain of NOTCH1 (NECD1), it is possible that the IL-17R–NECD1 interaction may disrupt the inhibitory effect of the negative regulatory region of NOTCH1, facilitating ADAM-mediated NOTCH1 cleavage at cleavage site S2 followed by cleavage at S3 and S4 by the intramembrane γ-secretase complex for NOTCH1 activation. Alternatively, the IL-17R–NECD1 interaction may transduce the signal to the Notch1 transmembrane domain, directly promoting cleavage at S3 and S4 via the intramembrane γ-secretase complex to release NICD1. Future studies are required to elucidate the detailed molecular mechanism by which the IL-17RA–NOTCH1 interaction promotes NOTCH1 activation.

The Th17 and IL-17 pathways play an essential role in many autoimmune diseases including MS 39, 40 . Specific ablation of Act1, NOTCH1 and RBP-J in OPCs greatly attenuated EAE development, suggesting that OPCs are the major CNS cellular target of the IL-17 and NOTCH pathways in EAE 19 . While IL-17 induced a characteristic inflammatory response in OPCs ex vivo , IL-17 also crosstalks with NOTCH1 to upregulate Th17-induced NOTCH1 target genes that are important for both inflammation and cell proliferation. The knowledge that most OPCs are NOTCH1-positive suggests that IL-17RA–NOTCH crosstalk is probably the dominant mode of OPC signalling in response to IL-17 stimulation. In support of this hypothesis, RA peptide that blocks IL-17RA–NOTCH1 interaction inhibited IL-17-induced NOTCH1 activation and Th17-mediated EAE, indicating a critical impact of the IL-17–NOTCH1 axis in Th17–IL-17-dependent EAE pathogenesis. Based on our findings, we propose that the IL-17/Act1/NOTCH axis has dual roles in progenitor cells. While IL-17/NOTCH induces inflammatory gene expression, it also promotes progenitor cell proliferation via some of the target genes such as STEAP4 . Both processes can be inhibitory to the normal differentiation programme of the progenitor cells (to become mature oligodendrocytes), resulting in a lack of sufficient remyelination (contributing to demyelination). Future studies are required to carefully determine the relative importance of NOTCH1 canonical versus Th17-induced target genes in OPC proliferation/differentiation and consequent demyelinating disease.

Metodai

Pelės

B6.129X1-Notch1 tm2Rko /GridJ (stock number 006951), Jag1 tm2Grid /J (stock number 010618) and B6.Cg-Tg (Cspg4-cre/Esr1*) BAkik/J (stock number 008538) were purchased from Jackson Laboratory. RBP-J fl / fl mice were provided by Dr Tasuku Honjo and Dr Hu, Xiaoyu at Kyoto University and Tsinghua University. LSL–HA–Act1 knock-in mice were generated on a C57BL/6 background by replacing exon 2 of Traf3ip2 with a LoxP-Stop-LoxP-Traf3ip2 cDNA-HA Tag-PolyA cassette. All the mice used in this study were female. For all experiments, the mice were age-matched (8–12 weeks) littermates between experimental groups. The mice were housed under specific pathogen-free conditions. All animal studies were approved by the Institutional Animal Care and Use Committee of Cleveland Clinic.

Ląstelės

The HEK293T and HeLa cell lines were obtained from the ATCC and authenticated by analysing the morphology, growth curve and isoenzyme. Cells were tested for mycoplasma contamination and were shown to be mycoplasma negative. Both of these two cell lines were cultured in DMEM containing 10% heat-inactivated FBS (foetal bovine serum, Gibco Cat: 10, 438, 026) and 1% pen/strep (Thermo Fisher Scientific, Cat: 15, 140, 122).

Reagentai

For immunoblot analysis, antibodies against NOTCH1, MAML1, PCAF, RBP-J, NICD1, Jagged1, cleaved NOTCH1, rabbit control IgG, cleaved caspase-3, α-tubulin, H3, Myc, p-IκB α , p-p65, p-ERK, FLAG, HA and GFP were purchased from Cell Signaling Biotechnology (CST, Cat No. 3, 447, 11, 959, 3, 378, 5, 313, 4, 147, 2, 620, 4, 147, 3, 900, 9, 664, 3, 873, 4, 499, 2, 276, 2, 859, 3, 033, 4, 370, 14, 793, 3, 724 and 2, 956); antibodies against Act1, P300, TRAF6 were purchased from Santa Cruz Biotechnology (sc-11, 444, sc-584 and sc-7, 221); the antibody against Actin was purchased from Sigma (A5, 441); and the antibody against V5 was from Thermo Fisher Scientific (MA5-15, 253). All antibodies were used at a dilution of 1:1, 000 for western blotting unless otherwise specified. For immunofluorescence, antibodies against FLGA and HA were purchased from CST (14, 793) and Sigma (H9, 658), respectively; the antibody against NG2 was provided by WB Stallcup (Burnham Institute for Medical Research); the antibody against Ki67 was purchased from Abcam (Cat No. ab15, 580); the antibody against cleaved NOTCH1 was from Abcam (ab8925); the antibody against GST-π was from CST (3, 174) and Enzo (ADI-MSA-102-E); and the antibody against PDGFRα was from eBioscience (14-1, 401-81). Antisera against STEAP4, IL-17RA or Act1 was generated by Covance using selected peptides as immunogens. 4, 6-Diamidino-2-phenylindole (DAPI) was purchased from Sigma (D5942). All antibodies were used at a dilution of 1:1, 000 for western blotting unless otherwise specified.

Plazmidės

Human NOTCH1 and Act1 cDNA were cloned into the pCDNA3.1 (+) vector with FLAG or HA sequences appended to the C terminus of the protein. FLAG–GFP–NOTCH1, GFP–NICD1 and GFP–NECD1 plasmids were kindly provided by Dr Valina L. Dawson at Johns Hopkins University School of Medicine. FLAG–NICD1 was kindly provided by Dr Xiaoxu Hu at Tsinghua University. FLAG and V5 tagged IL-17RA plasmids were generated by cloning human IL-17RA into pCDNA3.1 (+) vector with V5 or FLAG sequence appended to the C terminus. IL-17RA deletion mutants and Act1 deletion mutants were constructed using a Quick Change mutagenesis kit from Agilent (200, 518) according to the manufacturer's instruction. The primers used for mutagenesis are listed in Supplementary Table 1.

Immunoblot and immunoprecipitation

Cells were collected and lysed on ice in lysis buffer containing 0.5% Triton X-100, 20 mM HEPES pH 7.4, 150 mM NaCl, 12.5 mM β-glycerophosphate, 1.5 mM MgCl 2, 10 mM NaF, 2 mM dithiothreitol, 1 mM sodium orthovanadate, 2 mM EGTA, 20 mM aprotinin and 1 mM phenylmethylsulfonyl fluoride for 20 min, followed by centrifugation at 12, 000 rpm for 15 min to extract clear lysates. For immunoprecipitation, the cell lysates were incubated with 1 μg of antibody and A-Sepharose beads at 4 °C overnight. After incubation, the beads were washed four times with lysis buffer, and the precipitates were eluted with 2 × sample buffer. The eluates and whole-cell extracts were resolved by SDS–PAGE followed by immunoblotting with antibodies. Nuclear fractionation was performed using the NUCLEI EZ PREP kit purchased from Sigma in accordance with the manufacturer's instructions. For cell fractionation, we used the NUCLEI EZ PREP NUCLEI ISOLATION KIT from Sigma (Cat No. NUC-101) to isolate nuclear and cytoplasmic proteins. Densitometric quantification of the western blot results was performed on images of scanned films using ImageJ software. All uncropped western blots can be found in Supplementary Fig. 9.

Imunofluorescencija

Transfected cells or frozen sections were fixed with 4% paraformaldehyde (PFA) followed by permeabilization with PBS containing 0.3% Triton X-100 for 10 min. Before incubation with primary antibody, the samples were incubated with 10% goat serum at room temperature for 1 h to block non-specific staining. After 12 h of incubation with primary antibody at 4 °C, the samples were washed three times with ice-cold PBS and further stained with fluorophore (Alex488 and Alexa 530)-conjugated secondary antibodies. After staining, the samples were counterstained with DAPI and immersed in mounting medium before being sealed on a slide with nail polish. The sealed slides were analysed using a Leica TCS-SP microscope with companion software. Quantification of immunofluorescent staining was performed by manually enumerating the number of positive cells in 20 views per biological or technical replicate.

Mass spectrometry identification

Samples were reduced and alkylated in dithiothreitol and iodoacetamide followed by trypsin digestion overnight. Digested samples were injected onto an Agilent Zorbax 300SB-C18 0.075 mm × 150 mm column on an Eskigent nanoLC system coupled to a Thermo LTQ-ETD-Orbitrap. The Advion Triversa NanoMate served as the nano-ion spray source. Mass spectrometry and tandem mass spectrometry (MSMS) data were searched against the RefSeq human protein database by Sorcerer Sequest (Sage-N Research, Milpitas, CA). The searched data set was processed using the TPP (trans-proteomics pipeline) and filtered with peptide prophet.

PLA

PLA was performed using the Duolink In Situ Red Kit purchased from Sigma (DUO92101) in accordance with the manufacturer's instruction. Briefly, transfected cells were washed once with ice-cold PBS, followed by fixation with 4% PFA for 15 min at room temperature. The fixed cells were then washed three times with PBS and permeabilized with 0.3% Triton X-100 containing PBS for 10 min. The permeabilized cells were blocked with 5% normal goat serum for 1 h at room temperature. The cells were then incubated with primary antibodies (rabbit anti-FLAG (CST 14793, 1:300 dilution) and mouse anti-HA (Sigma H9658, 1:300 dilution) diluted in 10% normal goat serum supplemented with 0.1% Tween at 4 °C overnight. Following the incubation, the cells were three times with PBS and then incubated with two PLA probes (Duolink In Situ PLA Probes Anti-rabbit PLUS and Anti-Mouse MINUS, Sigma-Aldrich) for 1 h at 37 °C. After probe incubation, the samples were incubated in ligation solution for 1 h at 37 °C. After ligation, the cells were washed with wash buffer A and incubated in amplification solution for 2 h at 37 °C. The cells were then serially washed twice in 1 × wash buffer B, 0.01 × wash buffer B once, and PBS once, followed by incubation with secondary antibodies for 1 h at room temperature. Finally, the cells were washed three times with PBS and mounted in Duolink In Situ Mounting Medium supplemented with DAPI. Fluorescent images were obtained using a confocal microscope.

Primary cell culture

The astrocyte culture was prepared from 1-day-old neonatal mice. Brains freed of meninges were dissociated with 1-ml pipettes. Debris was removed by filtration through a 70-μm cell strainer (Falcon). The cells were cultured in DMEM plus 10% foetal bovine serum (vol/vol) supplemented with 50 μg ml −1 penicillin and 50 μg ml −1 streptomycin. Ten days after the initial culture, cells were stained with antibody against GFAP (Sigma, G3893, 1:500) to verify the purity of the astrocytes. OPCs were derived from neurospheres. Embryos were dissected from pregnant mice 14 days after the last recording of a vaginal plug. Neurospheres were cultured in DMEM/F12 supplemented with B27 (Invitrogen) and 20 ng ml −1 recombinant mouse epidermal growth factor (R&D). Floating neurospheres were passaged at a 1:3 ratio in the same medium every 3 days. To produce pure OPCs, neurospheres were dissociated after two–three passages and plated on poly- D -lysine-coated plates in DMEM/F12 supplemented with B27 (Invitrogen), 20 ng ml −1 FGF and 10 ng ml −1 PDGF (Peprotech). The OPC purity was verified with anti-Olig2 and CNPase staining (>98% of cells were Olig2 + CNPase at 4 days after culture). For the OPC-astrocyte co-culture, astrocytes were plated in six-well plates at a density of 2 × 10 4 per well in DMEM/F12 supplemented with B27. On the following day, dissociated neurospheres were plated together with the astrocytes at a density of 5 × 10 5 per well. The culture medium was further supplemented with 20 ng ml −1 FGF+10 ng ml −1 PDGF to promote OPC differentiation. The co-culture was maintained for 4 more days before being subjected to experiments (for example, IL-17 treatment). To generate NOTCH1 and RBP-J knockout OPCs, neurospheres were prepared from NOTCH1 fl / fl and RBP-J fl / fl embryos. An adenovirus directing the expression of GFP (control) or Cre was added to the culture medium after neurosphere dissociation to mediate the deletion of floxed alleles. NOTCH1 and Jagged1-deficient astrocytes were isolated from NOTCH1 fl / fl and Jagged1 fl / fl neonatal mice, and deletion was achieved by adenovirus infection as described for the neurosphere. The Cre deletion was validated in OPCs for NG2-ER-cre. Cultured OPCs were collected and stained with anti-NG2 for cell sorting of NG2 + OPCs cells. Sorted cells were lysed, and western blotting was conducted to evaluate RBP-J expression in NG2 + cells from NG2-ER-cre; RBP-J fl /+ and NG2-ER-cre; RBP-J fl / fl mice.

Realaus laiko PGR

Total RNA was extracted from the spinal cord with TRIzol (Invitrogen) according to the manufacturer's instructions. Three micrograms of total RNA for each sample was reverse-transcribed using SuperScript II Reverse Transcriptase from Thermo Fisher Scientific. The resulting complementary DNA was analysed by real-time polymerase chain reaction (PCR) using SYBR Green Real-Time PCR Master Mix. All gene expression results are expressed as arbitrary units relative to the expression of Actb . The fold induction of gene expression in spinal cord after EAE induction was determined by dividing the relative abundance of experimental samples by the mean relative abundance of control samples from naive mice. The primer sequences for RT–PCR are listed in Supplementary Table 1.

Liuciferazės žurnalisto tyrimas

HeLa cells were transfected with 100 ng of a Hes1-luciferase reporter construct in a 12-well plate together with the combination of plasmids indicated in the figure legends. Forty-eight hours after transfection, the cells were lysed, and luciferase activity was determined using the luciferase assay system and chemiluminescent reagents from Promega.

Chromosomal immunoprecipitation

The binding of Act1 and RBP-J to promoters of STEAP4, PTX3, CCL7 and S100A9 was assessed by chromosomal immunoprecipitation (ChIP) using OPCs co-cultured with Act1 KO astrocytes. The ChIP assay was performed using the ChIP assay Kit from Active Motif in accordance with the manufacturer's instructions. Briefly, a total of 1 × 10 7 co-cultured cells was fixed with 1% formaldehyde. Fixed cells were sonicated for 30 s at medium power for 20 cycles, followed by centrifugation. The sonicated whole-cell extract was diluted in ChIP dilution buffer. The samples were incubated at 4 °C overnight with antibodies against RBP-J (CST 5313, diluted at 1:50), Act1 (Covance, diluted at 1:50) or rabbit IgG (CST Cat No. 3, 900, at 1:50) and A-Sepharose beads (Active Motif). The precipitates were washed and subjected to DNA extraction followed by RT–PCR analysis of promoter enrichment using the primers listed in Supplementary Table 1.

Mouse control primers for the Chip assay were purchased from Active Motif (71011).

Tamoxifen injection to deplete NOTCH1 and RBP-J in vivo

NG2-ER-cre; NOTCH1 fl /+ and NG2-ER-cre; NOTCH1 fl / fl mice and NG2-ER-cre; RBP-J fl /+ and NG2-ER-cre; RBP-J fl / fl mice (4 weeks old) were injected intraperitoneally with 5 mg of tamoxifen per week for at least 4 weeks.

GeneChip Microarray analysis

Five mice in each group were left untreated (naive group) or adoptively transferred with MOG-reactive Th1 or Th17 cells. Act1 KO mice received only the Th17 adoptive transfer. Twelve days after adoptive transfer, the mice were killed, and spinal cords were subjected to mRNA extraction for microarray analysis. Target preparation was performed on a Biomek FXP (Beckman Coulter, Brea, CA) using a GeneChip HT 3′IVT Express Kit (Affymetrix, Santa Clara, CA) in accordance with the manufacturer's instruction. Labelled cRNA was hybridized on an Affymetrix GeneChip HT-MG-430PM-96 (Affymetrix). Array hybridization, washing and scanning were performed using GeneTitan (Affymetrix). Three independent biological replicates were analysed in each experiment, which yielded consistent results. The t -test was used to assess significance, and P <0.05 was deemed significant. The data for the normalized GeneChip analysis are provided in Supplementary Data 1 and the raw data are deposited in the Gene Expression Omnibus.

Induction and assessment of EAE

Recipient mice were injected with 3.0 × 10 7 MOG 35–55 -reactive Th1 or Th17 cells at 4 h after 500-Rad sublethal irradiation. To prepare MOG 35–55 -reactive T cells, donor mice were immunized with MOG 35−55 subcutaneously; draining lymph node cells and splenocytes were prepared from donor mice at 10 days after immunization. The cells were cultured for 5 days with MOG 35–55 at a concentration of 25 μg ml −1 under either Th1-polarizing conditions (20 ng ml −1 ) rmIL-12, R&D; 2 μg ml −1 αIL-23p19, eBioscience) or Th17-polarizing conditions (20 ng ml −1 rmIL-23, R&D). Scoring of EAE symptoms was performed in a double-blinded manner. Power analysis was performed to determine the sample size before the experiment. With an average coefficient of variance of 25%, we determined that n =5 was needed to obtain 90% power for the detection of a 30% difference between the groups. The mice were weighed and assigned scores daily for neurological signs according to the following scale: 0, no disease; 1, decreased tail tone or slightly clumsy gait; 2, tail atony and/or moderately clumsy gait and/or poor slighting ability; 3, limb weakness; 4, limb paralysis; 5, moribund state or death. The control and experimental groups were blinded to the investigators who recorded the clinical score, flow analysis, histology and Luxol fast blue (LFB) staining.

Isolation and analysis of CNS inflammatory cells

Brains were homogenized in ice-cold tissue grinders and filtered through a 70-μm cell strainer, and the cells were collected by centrifugation at 400 g for 5 min at 4 °C. The cells were re-suspended in 10 ml of 30% Percoll (Amersham Bioscience) and centrifuged onto a 70% Percoll cushion in 15-ml tubes at 800 g for 30 min. The cells in the 30–70% interface were collected and subjected to flow cytometry. The gross cell population was first gated based on the forward and side scatter for viable, single cell events. Fluorescence-conjugated monoclonal antibodies against CD4 (clone GK1.5), CD8 (clone 53-6.7), CD45 (clone 30-F11), Ly6G (clone 1A8), CD19 (clone 1D3) and iso-type controls were purchased from BD Biosciences. F4/80 (clone Cl:A3-1) was obtained from Serotech. The antibodies were diluted 1:200–1:400 for use.

Histologinė analizė

All sections used herein were 5-μm thick. For paraffin-embedded tissue, spinal cords collected from phosphate-buffered saline-perfused mice were fixed in 10% formalin and then dehydrated with 70% alcohol. The sections were stained with either haematoxylin and eosin (H&E) or LFB to evaluate inflammation and demyelination, respectively. For cytohistochemical staining, the cells were fixed in 2% PFA for 10 min. The cells were further permeabilized with 0.1% Triton X-100 for 10 min and then incubated with primary antibody followed by fluorescence-conjugated secondary antibodies for microscopic analysis. NG2 antibodies were provided by WB Stallcup (Burnham Institute for Medical Research). Histological quantification was performed in a double-blinded manner.

Peptide

Scramble and IL-17RA decoy peptides were synthesized as described 38 . The scramble peptide sequence is 'PRFASPCCVFCTPDVPQSYTNVVLLITIHVVDQPAKSNVS', and the decoy peptide sequence is 'VQVQPFFSSCLNDCLRHAVTVPCPVISNTTVPKPVADYIP'.

Osmotic pump implantation

Control or IL-17RA decoy peptide was dissolved in sterile artificial cerebrospinal fluid (CSF). Micro-osmotic pumps (Alzet) were filled with dissolved peptides and placed in the bottom of a 200-ml glass beaker that was half filled with sterile 0.9% NaCl in a humidified 37 °C incubator overnight for activation. Mice were anaesthetized with a ketamine (100 mg kg −1 ) and xylazine (10 mg kg −1 ) cocktail. Anaesthetized mice were placed in a stereotactic device with a three-axis chronic micromanipulator. The injection coordinates were 1 mm lateral, 0.3 mm posterior and 2 mm deep to the bregma. The overlying skin was cut to form a 0.7 cm incision in the head and a 0.5 cm incision in the back of the mouse right below the neck. The cranium was opened using a compact drill followed by insertion of the infusion cannula (2 mm in depth). Osmotic pumps were implanted in the back of the mice. A pocket was made to connect the infusion pump so that the incision site was not directly over the pump. Implanted mice were housed in separate cages to avoid fighting. Three days after pump implantation, Th17 cells were adoptively transferred into the mice by intraperitoneal injection.

Statistika

For comparison between two groups, normality was not assessed for the statistical analysis. Non-parametric statistics were applied to compare differences between two groups. The Mann–Whitney U -test was used to derive all P values. The clinical scores in the EAE experiment were analysed with two-way ANOVA for multiple comparisons. The sample size for the EAE experiment was estimated by power analysis assuming a normal distribution of the data. No randomization was performed. P <0, 05 buvo laikomas reikšmingu. The results are presented as the mean, and the error bars represent the sem technical or biological replicates as indicated in the figure legend.

Duomenų prieinamumas

All data supporting the findings of this study are available within the article and its Supplementary Information files or from the corresponding authors on reasonable request. The GeneChip microarray data described in the study have been deposited in the Gene Expression Omnibus under accession code GSE97035.

Papildoma informacija

How to cite this article: Wang, C. et al . IL-17 induced NOTCH1 activation in oligodendrocyte progenitor cells enhances proliferation and inflammatory gene expression. Nat. Bendruomenė. 8, 15508 doi: 10.1038/ncomms15508 (2017).

Leidėjo pastaba: „ Springer Nature“ išlieka neutralus paskelbtų žemėlapių jurisdikcijos reikalavimų ir institucinių ryšių atžvilgiu.

Papildoma informacija

PDF failai

  1. 1.

    Papildoma informacija

    Supplementary Figures, Supplementary Tables.

„Excel“ failai

  1. 1.

    Papildomi duomenys 1

    Microarray analysis of the gene expression in spinal cords of Th1- and Th17- induced EAE mice.

Komentarai

Pateikdami komentarą jūs sutinkate laikytis mūsų taisyklių ir bendruomenės gairių. Jei pastebite ką nors įžeidžiančio ar neatitinkančio mūsų taisyklių ar gairių, pažymėkite, kad tai netinkama.